PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015216
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 379aa    MW: 41512 Da    PI: 7.6336
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689332PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-52788PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.6e-31221276156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rF++ ++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Lsa015216 221 KARRCWSPELHRRFLHSLQQLGGAHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 276
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.515218278IPR017930Myb domain
SuperFamilySSF466895.08E-17219279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-27219279IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-26221276IPR006447Myb domain, plants
PfamPF002497.6E-6223274IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MVFHNNSTDF GEKMQRCREY MEALESERRK IQVFERELPL CLELVTQAIE GCKQQMSGTT  60
TDYFNGQSEC SEQTSSEGPI LEEFIPMKRT SSAHDEEDQQ QQQQQFNHKP KVISTKDKSS  120
FPSKKSDWLR SAQLSIQTPD PVELSPKRVS VVEVTRNGCG AFHPFKKEKT SDTAPVAGTG  180
KLSPAPAAGP TAAASSTAET GSGNGGCGES KSEDKGQSNR KARRCWSPEL HRRFLHSLQQ  240
LGGAHVATPK QIRELMKVDG LTNDEVKSHL QKYRLHTRRP TPTIHNNNNP QTPQFVVVGG  300
IWMTPPEYTT MAATSTPTSG ETNNSKGVYA PIASHPPSLP EASMSLNKSN SGEKDGGHSH  360
EDSPSTSSST HTTTASPVF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-148PREDICTED: probable transcription factor GLK2
TrEMBLA0A103XVG40.0A0A103XVG4_CYNCS; Homeodomain-like protein
STRINGVIT_01s0011g03110.t011e-145(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-101G2-like family protein